PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3431_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ZF-HD
Protein Properties Length: 272aa    MW: 31000.5 Da    PI: 9.6423
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3431_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.72.1e-3180135258
  ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  ++v+Y+eC++NhAa+ Ggh+vDGCgEfm+s geegta++l CaAC+CHR+FHR+e +
   RrC3431_p1  80 RNVKYRECQRNHAANSGGHVVDGCGEFMSS-GEEGTAESLLCAACDCHRSFHRKEID 135
                  589**************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-3268144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.0E-2981134IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.7E-2983134IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.41784133IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.24E-18200269IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-28201270IPR009057Homeodomain-like
TIGRFAMsTIGR015652.3E-28208265IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MEVREKKDDK IEMERRQSSA NQNIQDHHHH LPPYTYSQTA DKEKPTTKRN VSDPDQDPNP  60
ISIAPAPRSH SRAQTTSPTR NVKYRECQRN HAANSGGHVV DGCGEFMSSG EEGTAESLLC  120
AACDCHRSFH RKEIDGMFLV QFNSFGHSQR PLVNRHVSPI MMRFGGGGGG GGGGGRDPAV  180
AESSTEDLNR FHQALSGDGA DQFQYHPKKR FRTKFNQEQK EKMFEFAEKI GWRMNKTEDE  240
EVNRFCREIN VKRRVFKVWM HNNKQAAKKK KT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-192092641873ZF-HD homeobox family protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1251270KRRVFKVWMHNNKQAAKKKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325500.0AC232550.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH011J16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013695813.11e-171PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW71e-145ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A078JR931e-171A0A078JR93_BRANA; BnaCnng66730D protein
STRINGBra037224.1-P1e-167(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-142homeobox protein 24